PDB entry 3cg2

View 3cg2 on RCSB PDB site
Description: P38 Alpha Kinase complexed with a Pyrazolo-Pyrimidine based inhibitor
Class: transferase
Keywords: SERINE/THREONINE-PROTEIN KINASE, KINASE, TRANSFERASE, P38 MAP KINASE, Alternative splicing, ATP-binding, Cytoplasm, Nucleotide-binding, Nucleus, Phosphoprotein
Deposited on 2008-03-04, released 2008-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2010-03-02, with a file datestamp of 2010-02-26.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.296
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cg2a_
  • Heterogens: N4D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cg2A (A:)
    mahhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cg2A (A:)
    erptfyrqelnktiwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrt
    yrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvq
    fliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglartrwyrapeimlnqtv
    diwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyiqsltq
    mpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepvadpyd
    qsfesrdllidewksltydevisfvpp