PDB entry 3cfs

View 3cfs on RCSB PDB site
Description: Structural basis of the interaction of RbAp46/RbAp48 with histone H4
Class: histone/chaperone
Keywords: RbAp46/RbAp48, Chromatin, Histone, WD-40 repeat protein, chaperone, Acetylation, Chromatin regulator, DNA replication, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, WD repeat, Chromosomal protein, Nucleosome core, HISTONE-CHAPERONE COMPLEX
Deposited on 2008-03-04, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: Histone-binding protein RBBP7
    Species: HOMO SAPIENS
    Gene: RBBP7
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cfsb_
  • Chain 'E':
    Compound: histone h4
    Species: HOMO SAPIENS
    Gene: HIST1H4A
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ARS, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cfsB (B:)
    hmamaskemfedtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpeg
    kdyalhwlvlgthtsdeqnhlvvarvhipnddaqfdashcdsdkgefggfgsvtgkiece
    ikinhegevnrarympqnphiiatktpssdvlvfdytkhpakpdpsgecnpdlrlrghqk
    egyglswnsnlsghllsasddhtvclwdinagpkegkivdakaiftghsavvedvawhll
    heslfgsvaddqklmiwdtrsnttskpshlvdahtaevnclsfnpysefilatgsadktv
    alwdlrnlklklhtfeshkdeifqvhwsphnetilassgtdrrlnvwdlskigeeqsaed
    aedgppellfihgghtakisdfswnpnepwvicsvsednimqiwqmaeniynde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfsB (B:)
    fedtveervineeykiwkkntpflydlvmthalqwpsltvqwlpevtkpegkdyalhwlv
    lgthtsdeqnhlvvarvhipnddtgkieceikinhegevnrarympqnphiiatktpssd
    vlvfdytkhpakpdpsgecnpdlrlrghqkegyglswnsnlsghllsasddhtvclwdin
    agpkegkivdakaiftghsavvedvawhllheslfgsvaddqklmiwdtrsnttskpshl
    vdahtaevnclsfnpysefilatgsadktvalwdlrnlklklhtfeshkdeifqvhwsph
    netilassgtdrrlnvwdlskigeeqsaedaedgppellfihgghtakisdfswnpnepw
    vicsvsednimqiwqmaeniynd
    

  • Chain 'E':
    No sequence available.