PDB entry 3cfn

View 3cfn on RCSB PDB site
Description: Crystal structure of human transthyretin in complex with 1-anilino-8-naphthalene sulfonate
Class: transport protein
Keywords: human transthyretin, amyloid, familial amyloid polyneurophaty, 1, 8-2AN, Disease mutation, Glycoprotein, Hormone, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-03-04, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.203
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfna_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfnb_
  • Heterogens: 2AN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3cfnA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

    Sequence, based on observed residues (ATOM records): (download) 
    >3cfnA (A:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3cfnB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnpke

    Sequence, based on observed residues (ATOM records): (download) 
    >3cfnB (B:)
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn