PDB entry 3cfk

View 3cfk on RCSB PDB site
Description: Crystal structure of catalytic elimination antibody 34E4, triclinic crystal form
Class: immune system
Keywords: IMMUNOGLOBULIN, CATALYTIC ANTIBODY, CHIMERIC FAB, APO FORM, PROTON TRANSFER, CONFORMATIONAL CHANGE, IMMUNE SYSTEM, CHIMERA, Immunoglobulin domain, Immunoglobulin V region
Deposited on 2008-03-04, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfka1, d3cfka2
  • Chain 'B':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkb1, d3cfkb2
  • Chain 'C':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfkc1, d3cfkc2
  • Chain 'D':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkd1, d3cfkd2
  • Chain 'E':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfke1, d3cfke2
  • Chain 'F':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkf1, d3cfkf2
  • Chain 'G':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfkg1, d3cfkg2
  • Chain 'H':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkh1, d3cfkh2
  • Chain 'I':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfki1, d3cfki2
  • Chain 'J':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfkj1, d3cfkj2
  • Chain 'K':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkk1, d3cfkk2
  • Chain 'L':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfkl1, d3cfkl2
  • Chain 'M':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfkm1, d3cfkm2
  • Chain 'N':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkn1, d3cfkn2
  • Chain 'O':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfko1, d3cfko2
  • Chain 'P':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN,Uncharacterized protein
    Species: , [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFK (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfkp1, d3cfkp2
  • Heterogens: CD, GOL, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfkA (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkA (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cfkB (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkB (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cfkC (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkC (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cfkD (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkD (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cfkE (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkE (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cfkF (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkF (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cfkG (G:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkG (G:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cfkH (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkH (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3cfkI (I:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkI (I:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3cfkJ (J:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkJ (J:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3cfkK (K:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkK (K:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cfkL (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkL (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >3cfkM (M:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkM (M:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3cfkN (N:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkN (N:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3cfkO (O:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkO (O:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3cfkP (P:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfkP (P:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk