PDB entry 3cfj

View 3cfj on RCSB PDB site
Description: Crystal structure of catalytic elimination antibody 34E4, orthorhombic crystal form
Class: immune system
Keywords: IMMUNOGLOBULIN, CATALYTIC ANTIBODY, CHIMERIC FAB, APO FORM, PROTON TRANSFER, CONFORMATIONAL CHANGE, IMMUNE SYSTEM, Immunoglobulin domain, Immunoglobulin V region
Deposited on 2008-03-04, released 2008-04-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-07-19, with a file datestamp of 2017-07-14.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfja1, d3cfja2
  • Chain 'B':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfjb1, d3cfjb2
  • Chain 'C':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfjc1, d3cfjc2
  • Chain 'D':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfjd1, d3cfjd2
  • Chain 'E':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfje1, d3cfje2
  • Chain 'F':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfjf1, d3cfjf2
  • Chain 'H':
    Compound: CATALYTIC ANTIBODY FAB 34E4 HEAVY CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-112)
    • Uniprot A8K008 (113-End)
      • engineered mutation (117)
    Domains in SCOPe 2.07: d3cfjh1, d3cfjh2
  • Chain 'L':
    Compound: CATALYTIC ANTIBODY FAB 34E4 LIGHT CHAIN fusion
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFJ (0-106)
    • Uniprot Q8TCD0 (107-End)
    Domains in SCOPe 2.07: d3cfjl1, d3cfjl2
  • Heterogens: GOL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfjA (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjA (A:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cfjB (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjB (B:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cfjC (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjC (C:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cfjD (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjD (D:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cfjE (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjE (E:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cfjF (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjF (F:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cfjH (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepkscd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjH (H:)
    evkllesggglaqpggslklscaasgfdfrrywmtwvrqapgkglewigeinpdsrtiny
    mpslkdkfiisrdnaknslylqlsrlrsedsalyycvrldfdvynhyyvldywgqgtsvt
    vssastkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavl
    qssglyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cfjL (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfjL (L:)
    elvvtqesalttspgetvtltcrsssgavttsnyatwvqekpdhlftgliggtnkrapgv
    parfsgsligdraaltitgaqtedeaiyfcalwnsnhlvfgggtkleikrtvaapsvfif
    ppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsst
    ltlskadyekhkvyacevthqglsspvtksfnrge