PDB entry 3cfi

View 3cfi on RCSB PDB site
Description: Nanobody-aided structure determination of the EPSI:EPSJ pseudopilin heterdimer from Vibrio Vulnificus
Class: PROTEIN TRANSPORT/Immune system
Keywords: General Secretory Pathway, Pseudopilins, Single Chain Antibody, Methylation, PROTEIN TRANSPORT-Immune system COMPLEX
Deposited on 2008-03-03, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.58 Å
R-factor: 0.232
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Type II secretory pathway, pseudopilin EpsI
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfia_
  • Chain 'B':
    Compound: Type II secretory pathway, PSEUDOPILIN EpsJ
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsj
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MPZ0
      • see remark 999 (55)
      • see remark 999 (136)
    Domains in SCOPe 2.07: d3cfib_
  • Chain 'C':
    Compound: Nanobody NBEPSIJ_11
    Species: Lama glama [TaxId:9844]
    Gene: NBEPSIJ_11
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFI (Start-115)
    Domains in SCOPe 2.07: d3cfic1, d3cfic2
  • Chain 'D':
    Compound: Type II secretory pathway, pseudopilin EpsI
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfid_
  • Chain 'E':
    Compound: Type II secretory pathway, PSEUDOPILIN EpsJ
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsj
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MPZ0 (0-163)
      • see remark 999 (55)
      • see remark 999 (136)
    Domains in SCOPe 2.07: d3cfie_
  • Chain 'F':
    Compound: Nanobody NBEPSIJ_11
    Species: Lama glama [TaxId:9844]
    Gene: NBEPSIJ_11
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFI
    Domains in SCOPe 2.07: d3cfif1, d3cfif2
  • Chain 'G':
    Compound: Type II secretory pathway, pseudopilin EpsI
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfig_
  • Chain 'H':
    Compound: Type II secretory pathway, PSEUDOPILIN EpsJ
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsj
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MPZ0
      • see remark 999 (55)
      • see remark 999 (136)
    Domains in SCOPe 2.07: d3cfih_
  • Chain 'I':
    Compound: Nanobody NBEPSIJ_11
    Species: Lama glama [TaxId:9844]
    Gene: NBEPSIJ_11
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFI (0-115)
    Domains in SCOPe 2.07: d3cfii1, d3cfii2
  • Chain 'J':
    Compound: Type II secretory pathway, pseudopilin EpsI
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsi
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cfij_
  • Chain 'K':
    Compound: Type II secretory pathway, PSEUDOPILIN EpsJ
    Species: Vibrio vulnificus [TaxId:672]
    Gene: epsj
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7MPZ0
      • see remark 999 (55)
      • see remark 999 (136)
    Domains in SCOPe 2.07: d3cfik_
  • Chain 'L':
    Compound: Nanobody NBEPSIJ_11
    Species: Lama glama [TaxId:9844]
    Gene: NBEPSIJ_11
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFI
    Domains in SCOPe 2.07: d3cfil1, d3cfil2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfiA (A:)
    intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
    afdvsvaaekqaspiitvrsyvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiA (A:)
    yleqkmfaamvadnqmamvmlnknlkasngeeelagqtwywkvapvattqplkafdvsva
    aekqaspiitvrsyva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cfiB (B:)
    nelsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgim
    farlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnv
    rfydgkqwinewsneltlpaaisveltlkdygkiartyltpegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiB (B:)
    elsqertarlnelqralvmmdsdfrqialrqtrtngeskkllhwadylldsdnkgimfar
    lgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfy
    dgkqwinewsneltlpaaisveltlkdygkiartyltpeg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cfiC (C:)
    qvqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyt
    apvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiC (C:)
    vqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyta
    pvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cfiD (D:)
    intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
    afdvsvaaekqaspiitvrsyvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiD (D:)
    intvgyleqkmfaamvadnqmamvmlnpnlkasngeeelagqtwywkvapvattllkafd
    vsvaaekqaspiitvrsyva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cfiE (E:)
    nelsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgim
    farlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnv
    rfydgkqwinewsneltlpaaisveltlkdygkiartyltpegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiE (E:)
    nelsqertarlnelqralvmmdsdfrqialrqtrtnskkllhwadylldsdnkgimfarl
    gwhnpqqprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfydgk
    qwinewsneltlpaaisveltlkdygkiartyltpegn
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cfiF (F:)
    qvqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyt
    apvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiF (F:)
    vqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyta
    pvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtv
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3cfiG (G:)
    intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
    afdvsvaaekqaspiitvrsyvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiG (G:)
    intvgyleqkmfaamvadnqmamvmlnpknkasngeeelagqtwywkvapvalkafdvsv
    aaekqspiitvrsy
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cfiH (H:)
    nelsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgim
    farlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnv
    rfydgkqwinewsneltlpaaisveltlkdygkiartyltpegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiH (H:)
    elsqertarlnelqralvmmdsdfrqialrqtrtngekkllhwadylldsdnkgimfarl
    gwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfyd
    gkqwinewsneltlpaaisveltlkdygkiartyltp
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cfiI (I:)
    qvqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyt
    apvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3cfiJ (J:)
    intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
    afdvsvaaekqaspiitvrsyvak
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiJ (J:)
    intvgyleqkmfaamvadnqmamvmlnpknlkasngeeelagqtwywkvapvattqpllk
    afdvsvaaekqaspiitvrsy
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >3cfiK (K:)
    nelsqertarlnelqralvmmdsdfrqialrqtrtngeepskkllhwadylldsdnkgim
    farlgwhnpqqqfprgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnv
    rfydgkqwinewsneltlpaaisveltlkdygkiartyltpegn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiK (K:)
    elsqertarlnelqralvmmdsdfrqialrqtrtpskkllhwadylldsdnkgimfarlg
    whnpqqqfgevtkvgyrikderlervwwrypdtpagqegvvtpllsdveelnvrfydgkq
    winewsneltlpaaisveltlkdygkiartylt
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cfiL (L:)
    qvqlqesggglvqpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsyt
    apvkgrftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfiL (L:)
    qlqesggglpggslrlscaasgfafsgyamswvrqapgkglewvsginrdgstsytapvk
    grftisrdnaknilylqmnslrpedtavyycakwlggrdwydrgqgtqv