PDB entry 3cfd

View 3cfd on RCSB PDB site
Description: Purple-fluorescent antibody EP2-25C10 in complex with its stilbene hapten
Class: immune system
Keywords: immunoglobulin, purple-fluorescent antibody, hapten complex, immune system
Deposited on 2008-03-03, released 2008-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.212
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purple-fluorescent antibody ep2-25c10-kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFD (0-End)
    Domains in SCOPe 2.07: d3cfda1, d3cfda2
  • Chain 'B':
    Compound: purple-fluorescent antibody ep2-25c10-igg2b heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFD (0-End)
  • Chain 'H':
    Compound: purple-fluorescent antibody ep2-25c10-igg2b heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFD (0-219)
  • Chain 'L':
    Compound: purple-fluorescent antibody ep2-25c10-kappa light chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 3CFD (0-End)
    Domains in SCOPe 2.07: d3cfdl1, d3cfdl2
  • Heterogens: SPB, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cfdA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfdA (A:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne
    

  • Chain 'B':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cfdL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrnec
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cfdL (L:)
    diqmtqttsslsaslgdrvtiscrasqdisnylnwyqqkpdgtvklliyytsrlhsgvps
    rfsgsgsgtdysltisnldqddiatyfcqqgttlpptfgggtkleikradaaptvsifpp
    sseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstlt
    ltkdeyerhnsytceathktstspivksfnrne