PDB entry 3cf9

View 3cf9 on RCSB PDB site
Description: Crystal structure of (3R)-Hydroxyacyl-Acyl Carrier Protein Dehydratase (FabZ) from Helicobacter pylori in complex with apigenin
Class: Lyase
Keywords: FabZ complex, apigenin, Cytoplasm, Lipid A biosynthesis, Lipid synthesis, Lyase
Deposited on 2008-03-03, released 2008-12-09
The last revision prior to the SCOPe 2.03 freeze date was dated 2008-12-09, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.192
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9a_
  • Chain 'B':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9b_
  • Chain 'C':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9c_
  • Chain 'D':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9d_
  • Chain 'E':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9e_
  • Chain 'F':
    Compound: (3R)-hydroxymyristoyl-acyl carrier protein dehydratase
    Species: Helicobacter pylori [TaxId:210]
    Gene: FabZ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3cf9f_
  • Heterogens: CL, AGI, BEN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cf9A (A:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9A (A:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cf9B (B:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9B (B:)
    qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
    vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
    miwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cf9C (C:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9C (C:)
    sqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvl
    ivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhk
    gmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cf9D (D:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9D (D:)
    lqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpg
    vlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlk
    hkgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cf9E (E:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9E (E:)
    qsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgv
    livegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkh
    kgmiwqvggtaqvdgkvvaeaelkamiaere
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cf9F (F:)
    meqshqnlqsqffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfp
    nkpifpgvlivegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrle
    yhlevlkhkgmiwqvggtaqvdgkvvaeaelkamiaere
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf9F (F:)
    qffiehilqilphrypmllvdritelqanqkivayknitfnedvfnghfpnkpifpgvli
    vegmaqsggflaftslwgfdpeiaktkivyfmtidkvkfripvtpgdrleyhlevlkhkg
    miwqvggtaqvdgkvvaeaelkamiae