PDB entry 3cf6

View 3cf6 on RCSB PDB site
Description: Structure of Epac2 in complex with cyclic-AMP and Rap
Class: signaling protein/GTP-binding protein
Keywords: epac, rapgef4, rap, rap1b, camp, sp-camps, gef, gunanine nucleotide exchange factor, g-protein, GTP-binding, nucleotide-binding, signaling protein regulator-GTP-binding protein complex, signaling protein-GTP-binding protein complex
Deposited on 2008-03-02, released 2008-07-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-02-05, with a file datestamp of 2014-01-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.244
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: Rap guanine nucleotide exchange factor (GEF) 4
    Species: Mus musculus [TaxId:10090]
    Gene: Rapgef4
    Database cross-references and differences (RAF-indexed):
  • Chain 'R':
    Compound: Ras-related protein Rap-1b
    Species: Homo sapiens [TaxId:9606]
    Gene: RAP1B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cf6r_
  • Heterogens: SO4, SP1, HOH

PDB Chain Sequences:

  • Chain 'E':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3cf6R (R:)
    mreyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvevdaqqcmleildtag
    teqftamrdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdl
    edervvgkeqgqnlarqwnncaflessakskinvneifydlvrqinr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf6R (R:)
    eyklvvlgsggvgksaltvqfvqgifvekydptiedsyrkqvqcmleildtagteqftam
    rdlymkngqgfalvysitaqstfndlqdlreqilrvkdtddvpmilvgnkcdledervvg
    keqgqnlaflessakskinvneifydlvrq