PDB entry 3cf1

View 3cf1 on RCSB PDB site
Description: Structure of P97/vcp in complex with ADP/ADP.alfx
Class: transport protein
Keywords: aaa, cdc48, erad, ATPase, transport protein
Deposited on 2008-03-01, released 2008-04-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 4.4 Å
R-factor: 0.229
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cf1a1, d3cf1a2, d3cf1a3, d3cf1a4
  • Chain 'B':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cf1b1, d3cf1b2, d3cf1b3, d3cf1b4
  • Chain 'C':
    Compound: Transitional endoplasmic reticulum ATPase
    Species: Mus musculus [TaxId:10090]
    Gene: VCP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cf1c1, d3cf1c2, d3cf1c3, d3cf1c4
  • Heterogens: ADP, AF3

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cf1A (A:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf1A (A:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakargdgggaadrvinqiltemdgmstkknvfiigatn
    rpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtngfsg
    adlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaqtlq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cf1B (B:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf1B (B:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cf1C (C:)
    masgadskgddlstailkqknrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllk
    gkkrreavcivlsddtcsdekirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpid
    dtvegitgnlfevylkpyfleayrpirkgdiflvrggmravefkvvetdpspycivapdt
    vihcegepikredeeeslnevgyddiggcrkqlaqikemvelplrhpalfkaigvkpprg
    illygppgtgktliaravanetgaffflingpeimsklagesesnlrkafeeaeknapai
    ifideldaiapkrekthgeverrivsqlltlmdglkqrahvivmaatnrpnsidpalrrf
    grfdrevdigipdatgrleilqihtknmkladdvdleqvanethghvgadlaalcseaal
    qairkkmdlidledetidaevmnslavtmddfrwalsqsnpsalretvvevpqvtwedig
    gledvkrelqelvqypvehpdkflkfgmtpskgvlfygppgcgktllakaianecqanfi
    sikgpelltmwfgeseanvreifdkarqaapcvlffdeldsiakarggnigdgggaadrv
    inqiltemdgmstkknvfiigatnrpdiidpailrpgrldqliyiplpdeksrvailkan
    lrkspvakdvdleflakmtngfsgadlteicqracklairesieseirrererqtnpsam
    eveeddpvpeirrdhfeeamrfarrsvsdndirkyemfaqtlqqsrgfgsfrfpsgnqgg
    agpsqgsgggtggsvytedndddlyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cf1C (C:)
    nrpnrlivdeainednsvvslsqpkmdelqlfrgdtvllkgkkrreavcivlsddtcsde
    kirmnrvvrnnlrvrlgdvisiqpcpdvkygkrihvlpiddtvegitgnlfevylkpyfl
    eayrpirkgdiflvrggmravefkvvetdpspycivapdtvihcegepikredeeeslne
    vgyddiggcrkqlaqikemvelplrhpalfkaigvkpprgillygppgtgktliaravan
    etgaffflingpeimsklagesesnlrkafeeaeknapaiifideldaiapkrekthgev
    errivsqlltlmdglkqrahvivmaatnrpnsidpalrrfgrfdrevdigipdatgrlei
    lqihtknmkladdvdleqvanethghvgadlaalcseaalqairkkmdlidledetidae
    vmnslavtmddfrwalsqsnpsalretvvevpqvtwediggledvkrelqelvqypvehp
    dkflkfgmtpskgvlfygppgcgktllakaianecqanfisikgpelltmwfgeseanvr
    eifdkarqaapcvlffdeldsiakarggnigdgggaadrvinqiltemdgmstkknvfii
    gatnrpdiidpailrpgrldqliyiplpdeksrvailkanlrkspvakdvdleflakmtn
    gfsgadlteicqracklairesieseivpeirrdhfeeamrfarrsvsdndirkyemfaq
    tlq