PDB entry 3cer

View 3cer on RCSB PDB site
Description: Crystal structure of the exopolyphosphatase-like protein Q8G5J2. Northeast Structural Genomics Consortium target BlR13
Class: structural genomics, unknown function
Keywords: NESG, BlR13, Q8G5J2, X-RAY, Structure, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2008-02-29, released 2008-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.221
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Possible exopolyphosphatase-like protein
    Species: Bifidobacterium longum [TaxId:206672]
    Gene: BL1019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G5J2 (Start-342)
      • engineered (259)
      • engineered (275)
    Domains in SCOPe 2.07: d3cera1
  • Chain 'B':
    Compound: Possible exopolyphosphatase-like protein
    Species: Bifidobacterium longum [TaxId:206672]
    Gene: BL1019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G5J2 (Start-342)
      • engineered (259)
      • engineered (275)
    Domains in SCOPe 2.07: d3cerb1
  • Chain 'C':
    Compound: Possible exopolyphosphatase-like protein
    Species: Bifidobacterium longum [TaxId:206672]
    Gene: BL1019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G5J2 (10-342)
      • engineered (259)
      • engineered (275)
    Domains in SCOPe 2.07: d3cerc1
  • Chain 'D':
    Compound: Possible exopolyphosphatase-like protein
    Species: Bifidobacterium longum [TaxId:206672]
    Gene: BL1019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G5J2
      • engineered (259)
      • engineered (275)
    Domains in SCOPe 2.07: d3cerd1
  • Chain 'E':
    Compound: Possible exopolyphosphatase-like protein
    Species: Bifidobacterium longum [TaxId:206672]
    Gene: BL1019
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8G5J2
      • engineered (259)
      • engineered (275)
    Domains in SCOPe 2.07: d3cere1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cerA (A:)
    mghhhhhhshmskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkt
    hrfadealerayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpe
    vipgteeadlsflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsm
    nigsvrmterhltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmta
    lamglkeydhtvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvws
    rvlarvseaakadhgeaidsfvasehglldgivldygrrllaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cerA (A:)
    esvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealerayv
    aarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsfl
    gatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsmnigsvrmterhlt
    ndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmtalamglkeydhtvv
    dghrlsfedayavddkflrmtraerreyktihpgridvvgggavvwsrvlarvseaakad
    hgeaidsfvasehglldgivldygrrllaq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cerB (B:)
    mghhhhhhshmskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkt
    hrfadealerayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpe
    vipgteeadlsflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsm
    nigsvrmterhltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmta
    lamglkeydhtvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvws
    rvlarvseaakadhgeaidsfvasehglldgivldygrrllaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cerB (B:)
    esvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealerayv
    aarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsfl
    gatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsmnigsvrmterhlt
    ndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmtalamglkeydhtvv
    dghrlsfedayavddkflrmtraerreyktihpgridvvgggavvwsrvlarvseaakad
    hgeaidsfvasehglldgivldygrrllaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cerC (C:)
    mghhhhhhshmskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkt
    hrfadealerayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpe
    vipgteeadlsflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsm
    nigsvrmterhltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmta
    lamglkeydhtvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvws
    rvlarvseaakadhgeaidsfvasehglldgivldygrrllaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cerC (C:)
    mskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealer
    ayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadl
    sflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsmnigsvrmter
    hltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmtalamglkeydh
    tvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvwsrvlarvseaa
    kadhgeaidsfvasehglldgivldygrrllaq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cerD (D:)
    mghhhhhhshmskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkt
    hrfadealerayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpe
    vipgteeadlsflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsm
    nigsvrmterhltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmta
    lamglkeydhtvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvws
    rvlarvseaakadhgeaidsfvasehglldgivldygrrllaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cerD (D:)
    kesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkthrfadealeray
    vaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsf
    lgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsmnigsvrmterhl
    tndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmtalamglkeydhtv
    vdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvwsrvlarvseaaka
    dhgeaidsfvasehglldgivldygrrlla
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cerE (E:)
    mghhhhhhshmskesvtvagidcgtnsirlkiarvdadgmhevvprilrvirlgqdvdkt
    hrfadealerayvaarefagviaehpidglrfvatsatrdaenreefedeierilgvrpe
    vipgteeadlsflgatsvvnrddlpapylvvdlgggstelviggdgvsapttqvqgafsm
    nigsvrmterhltndpptqtqideavadvdehideafrtvdagkartiigvsgtvttmta
    lamglkeydhtvvdghrlsfedayavddkflrmtraerreyktihpgridvvgggavvws
    rvlarvseaakadhgeaidsfvasehglldgivldygrrllaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cerE (E:)
    vtvagidcgtnsirlkiargmhevvprilrvirlgqdvdkthrfadealerayvaarefa
    gviaehpidglrfvatsatrdaenreefedeierilgvrpevipgteeadlsflgatsvv
    nrddlpapylvvdlgggstelviggdgvsapttqvqgafsmnigsvrmterhltndpptq
    tqideavadvdehideafrtvdagkartiigvsgtvttmtalamglkeydhtvvdghrls
    fedayavddkflrmtraerreyktihpgridvvgggavvwsrvlarvseaakadhgeaid
    sfvasehglldgivldygrrll