PDB entry 3ceh

View 3ceh on RCSB PDB site
Description: Human liver glycogen phosphorylase (tense state) in complex with the allosteric inhibitor AVE5688
Class: transferase
Keywords: protein ligand complex, tense state, allosteric inhibitor, Allosteric enzyme, Carbohydrate metabolism, Disease mutation, Glycogen metabolism, Glycogen storage disease, Glycosyltransferase, Nucleotide-binding, Phosphoprotein, Pyridoxal phosphate, Transferase
Deposited on 2008-02-29, released 2008-05-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.17
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glycogen phosphorylase, liver form
    Species: HOMO SAPIENS
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ceha_
  • Chain 'B':
    Compound: Glycogen phosphorylase, liver form
    Species: HOMO SAPIENS
    Gene: PYGL
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cehb_
  • Heterogens: NBG, PO4, PLP, AVE, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cehA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
    gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
    alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
    hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
    iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
    fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
    itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
    dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
    kniaasgkfssdrtikeyaqniwnvepsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cehA (A:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfdyiqavldrn
    laenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiql
    ndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllp
    rhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvak
    ihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsq
    ltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrql
    lnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvg
    sklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganv
    emaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdl
    fkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrti
    keyaqniwnvepsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cehB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfnlrdfnvgdy
    iqavldrnlaenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskfgstrga
    gtvfdafpdqvaiqlndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpe
    alerwpvdlvekllprhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinma
    hlcivgshavngvakihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglael
    iaekigedyvkdlsqltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssm
    fdvqvkriheykrqllnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiikl
    itsvadvvnndpmvgsklkviflenyrvslaekvipatdlseqistagteasgtgnmkfm
    lngaltigtmdganvemaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvi
    dqidngffspkqpdlfkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvl
    kniaasgkfssdrtikeyaqniwnvepsd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cehB (B:)
    nvaelkksfnrhlhftlvkdrnvattrdyyfalahtvrdhlvgrwirtqqhyydkcpkrv
    yylslefymgrtlqntminlglqnacdeaiyqlgldieeleeieedaglgngglgrlaac
    fldsmatlglaaygygiryeygifnqkirdgwqveeaddwlrygnpweksrpefmlpvhf
    ygkvehtntgtkwidtqvvlalpydtpvpgymnntvntmrlwsarapndfdyiqavldrn
    laenisrvlypndnffegkelrlkqeyfvvaatlqdiirrfkaskftvfdafpdqvaiql
    ndthpalaipelmrifvdieklpwskaweltqktfaytnhtvlpealerwpvdlvekllp
    rhleiiyeinqkhldrivalfpkdvdrlrrmslieeegskrinmahlcivgshavngvak
    ihsdivktkvfkdfselepdkfqnktngitprrwlllcnpglaeliaekigedyvkdlsq
    ltklhsflgddvflrelakvkqenklkfsqfleteykvkinpssmfdvqvkriheykrql
    lnclhvitmynrikkdpkklfvprtviiggkaapgyhmakmiiklitsvadvvnndpmvg
    sklkviflenyrvslaekvipatdlseqistagteasgtgnmkfmlngaltigtmdganv
    emaeeageenlfifgmriddvaaldkkgyeakeyyealpelklvidqidngffspkqpdl
    fkdiinmlfyhdrfkvfadyeayvkcqdkvsqlymnpkawntmvlkniaasgkfssdrti
    keyaqniwnvepsd