PDB entry 3ced

View 3ced on RCSB PDB site
Description: Crystal structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus
Class: hydrolase
Keywords: ABC transporter, NIL domain, Staphylococcus aureus, structural genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Amino-acid transport, ATP-binding, Hydrolase, Membrane, Nucleotide-binding
Deposited on 2008-02-28, released 2008-05-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Methionine import ATP-binding protein metN 2
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: metN2, SAV0837
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99VG8 (3-97)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3ceda1, d3ceda2
  • Chain 'B':
    Compound: Methionine import ATP-binding protein metN 2
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: metN2, SAV0837
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99VG8 (3-97)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3cedb2, d3cedb3
  • Chain 'C':
    Compound: Methionine import ATP-binding protein metN 2
    Species: Staphylococcus aureus [TaxId:158878]
    Gene: metN2, SAV0837
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99VG8 (3-97)
      • expression tag (0-2)
    Domains in SCOPe 2.08: d3cedc2, d3cedc3
  • Heterogens: BU1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cedA (A:)
snaddfetslteleplekdayivrlvfagstttepivsslstaydikinileanikntkn
gtvgflvlhipyissvdfgkfekelierqvkmevlrhg

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cedB (B:)
snaddfetslteleplekdayivrlvfagstttepivsslstaydikinileanikntkn
gtvgflvlhipyissvdfgkfekelierqvkmevlrhg

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cedC (C:)
snaddfetslteleplekdayivrlvfagstttepivsslstaydikinileanikntkn
gtvgflvlhipyissvdfgkfekelierqvkmevlrhg