PDB entry 3cec

View 3cec on RCSB PDB site
Description: Crystal structure of a putative antidote protein of plasmid maintenance system (npun_f2943) from nostoc punctiforme pcc 73102 at 1.60 A resolution
Class: transcription
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, transcription
Deposited on 2008-02-28, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative antidote protein of plasmid maintenance system
  Species: Nostoc punctiforme [TaxId:63737]
  Gene: ZP_00107635.1
  Database cross-references and differences (RAF-indexed):
  • PDB 3CEC (Start-103)
  Domains in SCOPe 2.08: d3ceca_
• Heterogens: MRD, PEG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3cecA (A:)
  gmdnwqditddrlvrpihpgeviadilddldintanfaeilgvsnqtiqevingqrsitv
  diairlgkalgngprlwlnlqqkvdlwyalqshkeeyeqvmtlv
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3cecA (A:)
  vrpihpgeviadilddldintanfaeilgvsnqtiqevingqrsitvdiairlgkalgng
  prlwlnlqqkvdlwyalqshkeeyeqvmtlv