PDB entry 3ceb

View 3ceb on RCSB PDB site
Description: crystal structure of a putative 4-amino-4-deoxychorismate lyase (hs_0128) from haemophilus somnus 129pt at 2.40 a resolution
Deposited on 2008-02-28, released 2008-03-18
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: D-aminoacid aminotransferase-like PLP-dependent enzyme
    Species: Histophilus somni [TaxId:205914]
    Gene: YP_718332.1, HS_0128
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0I0Z6 (1-193)
      • leader sequence (0)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3cebA (A:)
gmwqfplfetilieqgqaknisyhqqryeksllkfypkmklqpfdlakiiakhtalfthr
eglircridynhhdyvlqcfpyqqkvyrtfkpvfcdhidyslkfsdrtllnnllkqkeec
deimiirqgkvtdcsignlifrqnnqwitpdkpllegtqraklleqkkiiareiffedla
qyeeirlinamngl