PDB entry 3ce1

View 3ce1 on RCSB PDB site
Description: Crystal Structure of the Cu/Zn Superoxide Dismutase from Cryptococcus liquefaciens Strain N6
Class: oxidoreductase
Keywords: Greek-key beta barrel, Antioxidant, Copper, Metal-binding, Oxidoreductase, Zinc
Deposited on 2008-02-27, released 2008-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Cu-Zn]
    Species: Cryptococcus liquefaciens [TaxId:104408]
    Gene: C-SOD1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3ce1a_
  • Heterogens: ZN, ACT, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3ce1A (A:)
msstikaiavlkgdspvqgvitftqessggpvtvsgeiknmdanaqrgfhvhqfgdnsng
ctsagphfnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrt
ivihageddlgktdhpeslktgnagarsacgvigiaaaaalehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >3ce1A (A:)
ikaiavlkgdspvqgvitftqegpvtvsgeiknmdanaqrgfhvhqfgdnsngctsagph
fnptgtnhgdrtaevrhvgdlgnvktdasgvakvqisdsqlslvgphsiigrtivihage
ddlgktdhpeslktgnagarsacgvigiaa