PDB entry 3ce0

View 3ce0 on RCSB PDB site
Description: Human poly(ADP-ribose) polymerase 3, catalytic fragment in complex with an inhibitor PJ34
Class: transferase
Keywords: enzyme-inhibitor complex, catalytic fragment, Structural Genomics, Structural Genomics Consortium, SGC, Alternative splicing, Glycosyltransferase, NAD, Nucleus, Transferase
Deposited on 2008-02-27, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-16, with a file datestamp of 2009-06-12.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly [ADP-ribose] polymerase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: PARP3, ADPRT3, ADPRTL3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3ce0a1, d3ce0a2
  • Heterogens: P34

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3ce0A (A:)
    smkrvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealea
    leealkgptdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladiela
    qalqavseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptl
    qhiwkvnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyf
    asensksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarght
    epdptqdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ce0A (A:)
    krvqpcsldpatqklitnifskemfkntmalmdldvkkmplgklskqqiargfealeale
    ealkdggqsleelsshfytviphnfghsqpppinspellqakkdmllvladielaqalqa
    vseqektveevphpldrdyqllkcqlqlldsgapeykviqtyleqtgsnhrcptlqhiwk
    vnqegeedrfqahsklgnrkllwhgtnmavvaailtsglrimphsggrvgkgiyfasens
    ksagyvigmkcgahhvgymflgevalgrehhintdnpslkspppgfdsviarghtepdpt
    qdteleldgqqvvvpqgqpvpcpefssstfsqseyliyqesqcrlryllevh