PDB entry 3cdy

View 3cdy on RCSB PDB site
Description: AL-09 H87Y, immunoglobulin light chain variable domain
Class: immune system
Keywords: Greek key beta barrel, immunoglobulin, light chain, variable domain, amyloidosis, IMMUNE SYSTEM
Deposited on 2008-02-27, released 2008-09-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.193
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDY (Start-108)
    Domains in SCOPe 2.08: d3cdya_
  • Chain 'B':
    Compound: immunoglobulin light chain
    Species: Homo sapiens [TaxId:9606]
    Gene: kI O18/O8 germline
    Database cross-references and differences (RAF-indexed):
    • PDB 3CDY (Start-108)
    Domains in SCOPe 2.08: d3cdyb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cdyA (A:)
    stdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdyA (A:)
    tdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgvp
    srfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cdyB (B:)
    stdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgv
    psrfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleik
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdyB (B:)
    tdiqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgvp
    srfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleik