PDB entry 3cdn
View 3cdn on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera soaked at pH 4.0
Class: pheromone-binding protein
Keywords: honeybee, Apis mellifera, pheromone binding protein, signal transduction, queen mandibular pheromone, PHEROMONE-BINDING PROTEIN
Deposited on
2008-02-27, released
2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated
2019-12-25, with a file datestamp of
2019-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Pheromone-binding protein ASP1
Species: Apis mellifera [TaxId:7460]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d3cdna_ - Heterogens: CL, GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>3cdnA (A:)
apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
Sequence, based on observed residues (ATOM records): (download)
>3cdnA (A:)
wvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddea
nvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi