PDB entry 3cdn

View 3cdn on RCSB PDB site
Description: Crystal structure of a pheromone binding protein from Apis mellifera soaked at pH 4.0
Class: pheromone-binding protein
Keywords: honeybee, Apis mellifera, pheromone binding protein, signal transduction, queen mandibular pheromone, PHEROMONE-BINDING PROTEIN
Deposited on 2008-02-27, released 2008-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pheromone-binding protein ASP1
    Species: Apis mellifera [TaxId:7460]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3cdna_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cdnA (A:)
    apdwvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvd
    deanvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cdnA (A:)
    wvppevfdlvaedkarcmsehgttqaqiddvdkgnlvnepsitcymyclleafslvddea
    nvdedimlgllpdqlqeraqsvmgkclptsgsdncnkiynlakcvqesapdvwfvi