PDB entry 3cdd

View 3cdd on RCSB PDB site
Description: Crystal structure of prophage MuSo2, 43 kDa tail protein from Shewanella oneidensis
Class: structural protein
Keywords: MuSo2, Shewanella oneidensis MR-1, Structural Genomics, PSI-2, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, STRUCTURAL PROTEIN
Deposited on 2008-02-26, released 2008-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cdda1, d3cdda2
  • Chain 'B':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cddb1, d3cddb2
  • Chain 'C':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cddc1, d3cddc2
  • Chain 'D':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cddd1, d3cddd2
  • Chain 'E':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8EDP4 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.06: d3cdde1, d3cdde2, d3cdde3
  • Chain 'F':
    Compound: Prophage MuSo2, 43 kDa tail protein
    Species: Shewanella oneidensis [TaxId:211586]
    Gene: SO_2699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cddf1, d3cddf2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cddA (A:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddA (A:)
    seeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqac
    tvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqia
    divckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitra
    sktkagvslilgdnvkaargrfswrqrfskftikaakadvtdseigryrpliivneevta
    egaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeemlias
    ilfseddagrlavisvvrpdamdipaqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cddB (B:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddB (B:)
    eeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgqact
    vdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiad
    ivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitras
    ktkagvslilgdnvkaargrfswrqrfskftikggikadvtdseigryrpliivneevtt
    aegaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeemlia
    silfseddagrlavisvvrpdamdip
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3cddC (C:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddC (C:)
    eeivlkaggkiyqgwtkigitrsleamsgafdlemtykfqykafiepikqgqactvdigg
    ervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadivckp
    fgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitrasktkag
    vslilgdnvkaargrfswrqrfskftikadsaglptvggikadvtdseigryrpliivne
    evttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldee
    mliasilfseddagrlavisvvrpdamd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cddD (D:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddD (D:)
    seeivlkaggkiyqgwtkigitrsleamsgafdlemtykfndaqykafiepikqgqactv
    diggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadi
    vckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitrask
    tkagvslilgdnvkaargrfswrqrfskftikdsaglptvggikadvtdseigryrplii
    vneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgl
    deemliasilfseddagrlavisvvrpdamd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3cddE (E:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddE (E:)
    ghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqgq
    actvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltq
    iadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvit
    rasktkagvslilgdnvkaargrfswrqrfskftikdvtdseigryrpliivneevttae
    gaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeemliasi
    lfseddagrlavisvvrpdamd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cddF (F:)
    qghseeivlkaggkiyqgwtkigitrsleamsgafdlemtykflgndaqykafiepikqg
    qactvdiggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtlt
    qiadivckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvi
    trasktkagvslilgdnvkaargrfswrqrfskftikaagaahgqwdsaglptvggikad
    vtdseigryrpliivneevttaegaakrgqwerqrsigksnmaeytvtgwripqtgklwn
    intlvpvideimgldeemliasilfseddagrlavisvvrpdamdipaqivkdtklggst
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cddF (F:)
    eeivlkaggkiyqgwtkigitrsleamsgafdlemtykfndaqykafiepikqgqactvd
    iggervitgyvddwvpsydestitisvsgrdktadlvdcsidypsgqfnnqtltqiadiv
    ckpfgikvivntdvgepfqriqieqgetphellarlakqrgvlltsdtfgnlvitraskt
    kagvslilgdnvkaargrfswrqrfskftikaagikadvtdseigryrpliivneevtta
    egaakrgqwerqrsigksnmaeytvtgwripqtgklwnintlvpvideimgldeemlias
    ilfseddagrlavisvvrpdamdip