PDB entry 3cd8

View 3cd8 on RCSB PDB site
Description: X-ray Structure of c-Met with triazolopyridazine Inhibitor.
Class: transferase
Keywords: c-Met, Kinase, Triazolopyridazine, ATP-binding, Glycoprotein, Membrane, Nucleotide-binding, Phosphoprotein, Proto-oncogene, Receptor, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-02-26, released 2008-04-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.236
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581
      • variant (225)
    Domains in SCOPe 2.06: d3cd8a_
  • Heterogens: L5G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cd8A (A:)
    mqntvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cd8A (A:)
    dlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlkihcavkslnrigevs
    qfltegiimkdfshpnvlsllgicsplvvlpymkhgdlrnfirnethnptvkdligfglq
    vakgmkylaskkfvhrdlaarncmldekftvkvadfglardmydkeyysvhktgaklpvk
    wmaleslqtqkfttksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeyc
    pdplyevmlkcwhpkaemrpsfselvsrisaifstfig