PDB entry 3cd2

View 3cd2 on RCSB PDB site
Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+
Class: oxidoreductase
Keywords: oxido-reductase, methotrexate, nadph, oxidoreductase
Deposited on 1999-03-16, released 2000-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydrofolate reductase
    Species: Pneumocystis carinii [TaxId:4754]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cd2a_
  • Heterogens: NAP, MTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cd2A (A:)
    mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
    twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
    fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
    vgtkvphgkinedgfdyefemwtrdl