PDB entry 3cd2

View 3cd2 on RCSB PDB site
Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+
Class: oxidoreductase
Keywords: oxido-reductase, methotrexate, nadph
Deposited on 1999-03-16, released 2000-03-29
The last revision prior to the SCOP 1.75 freeze date was dated 2000-12-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.176
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dihydrofolate reductase
  Species: Pneumocystis carinii
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16184 (0-205)
  Domains in SCOP 1.75: d3cd2a_
• Heterogens: NAP, MTX, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cd2A (A:)
  mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
  twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
  fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
  vgtkvphgkinedgfdyefemwtrdl