PDB entry 3ccl

View 3ccl on RCSB PDB site
Description: Structure of Anisomycin resistant 50S Ribosomal Subunit: 23S rRNA mutation U2535C. Density for Anisomycin is visible but not included in model.
Class: ribosome
Keywords: U2535C mutation, 23S rRNA, large ribosomal subunit, RIBOSOME
Deposited on 2008-02-26, released 2008-05-20
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.171
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 23S ribosomal RNA
    Species: Haloarcula marismortui
  • Chain '1':
    Compound: 50S ribosomal protein L37e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccl11
  • Chain '2':
    Compound: 50S ribosomal protein L39e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccl21
  • Chain '3':
    Compound: 50S ribosomal protein L44E
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccl31
  • Chain '9':
    Compound: 5S ribosomal RNA
    Species: Haloarcula marismortui
  • Chain 'A':
    Compound: 50S ribosomal protein L2P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: 50S ribosomal protein L3P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclb1
  • Chain 'C':
    Compound: 50S ribosomal protein L4P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: 50S ribosomal protein L5P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccld1
  • Chain 'E':
    Compound: 50S ribosomal protein L6P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: 50S ribosomal protein L7Ae
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclf1
  • Chain 'G':
    Compound: 50S ribosomal protein L10e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: 50S ribosomal protein L10e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclh1
  • Chain 'I':
    Compound: 50S ribosomal protein L11P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccli1
  • Chain 'J':
    Compound: 50S ribosomal protein L13P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclj1
  • Chain 'K':
    Compound: 50S ribosomal protein L14P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclk1
  • Chain 'L':
    Compound: 50S ribosomal protein L15P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccll1
  • Chain 'M':
    Compound: 50S ribosomal protein L15e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
  • Chain 'N':
    Compound: 50S ribosomal protein L18P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccln1
  • Chain 'O':
    Compound: 50S ribosomal protein L18e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclo1
  • Chain 'P':
    Compound: 50S ribosomal protein L19e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclp1
  • Chain 'Q':
    Compound: 50S ribosomal protein L21e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclq1
  • Chain 'R':
    Compound: 50S ribosomal protein L22P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclr1
  • Chain 'S':
    Compound: 50S ribosomal protein L23P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccls1
  • Chain 'T':
    Compound: 50S ribosomal protein L24P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclt1
  • Chain 'U':
    Compound: 50S ribosomal protein L24e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclu1
  • Chain 'V':
    Compound: 50S ribosomal protein L29P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclv1
  • Chain 'W':
    Compound: 50S ribosomal protein L30P
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclw1
  • Chain 'X':
    Compound: 50S ribosomal protein L31e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cclx1
  • Chain 'Y':
    Compound: 50S ribosomal protein L32e
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3ccly1
  • Chain 'Z':
    Compound: 50S ribosomal protein L37Ae
    Species: Haloarcula marismortui
    Database cross-references and differences (RAF-indexed):
    • PDB 3CCL
    Domains in SCOPe 2.05: d3cclz1
  • Heterogens: MG, K, NA, CL, SR, CD, HOH

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >3ccl1 (1:)
    mtgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ccl1 (1:)
    tgagtpsqgkknttthtkcrrcgeksyhtkkkvcsscgfgksakrrdyewqskage
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >3ccl2 (2:)
    mgkkskatkkrlakldnqnsrvpawvmlktdrevqrnhkrrhwrrndtde
    

    Sequence, based on observed residues (ATOM records): (download)
    >3ccl2 (2:)
    gkkskatkkrlakldnqnsrvpawvmlktdrrnhkrrhwrrndtde
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3ccl3 (3:)
    mqmprrfntycphcnehqehevekvrsgrqtgmkwidrqrernsgigndgkfskvpggdk
    ptkktdlkyrcgecgkahlregwragrlefqe
    

  • Chain '9':
    No sequence available.

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cclB (B:)
    mpqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepn
    spregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedh
    dpdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhal
    divedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignl
    gpwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkg
    svpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclB (B:)
    pqpsrprkgslgfgprkrstsetprfnswpsddgqpgvqgfagykagmthvvlvndepns
    pregmeetvpvtvietppmravalrayedtpygqrpltevwtdefhseldrtldvpedhd
    pdaaeeqirdaheagdlgdlrlithtvpdavpsvpkkkpdvmetrvgggsvsdrldhald
    ivedggehamndifrageyadvagvtkgkgtqgpvkrwgvqkrkgkharqgwrrrignlg
    pwnpsrvrstvpqqgqtgyhqrtelnkrlidigegdeptvdggfvnygevdgpytlvkgs
    vpgpdkrlvrfrpavrpndqprldpevryvsnesnqg
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3cclD (D:)
    mssesesggdfhemrepriekvvvhmgighggrdlanaedilgeitgqmpvrtkakrtvg
    efdiregdpigakvtlrdemaeeflqtalplaelatsqfddtgnfsfgveehtefpsqey
    dpsigiygldvtvnlvrpgyrvakrdkasrsiptkhrlnpadavafiestydvevse
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclD (D:)
    fhemrepriekvvvhmgighanaedilgeitgqmpvrtkakrtvgefdiregdpigakvt
    lrdemaeeflqtalplaelatsqfddtgnfsfgldvtvnlvrpgyrvakrdkasrsiptk
    hrlnpadavafiestydvev
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3cclF (F:)
    mpvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeei
    vmhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclF (F:)
    pvyvdfdvpadleddalealevardtgavkkgtnettksiergsaelvfvaedvqpeeiv
    mhipeladekgvpfifveqqddlghaaglevgsaaaavtdageadadvediadkveelr
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3cclH (H:)
    msdkpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvql
    rhgsleasrlsanrhlikelgeegdykmtlrkfphqvlrenkqatgagadrvsdgmraaf
    gkivgtaarvqageqlftaycnvedaehvkeafrraynkitpscrikvergeellia
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclH (H:)
    kpasmyrdidkpaytrreyitgipgskiaqhkmgrkqkdaddypvqisliveetvqlrhg
    sleasrlsanrhlikelgeegdykmtlrkfphqvlrenkdgmraafgkivgtaarvqage
    qlftaycnvedaehvkeafrraynkitpscrikvergeel
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >3cclI (I:)
    magtievlvpggeanpgpplgpelgptpvdvqavvqeindqtaafdgtevpvtvkydddg
    sfeievgvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltna
    akevvgtctslgvtiegenprefkeridageyddvfaaeaqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclI (I:)
    gvpptaelikdeagfetgsgepqedfvadlsvdqvkqiaeqkhpdllsydltnaakevvg
    tctslgvtie
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >3cclJ (J:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclJ (J:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgtsldr
    lsnikfvtlgeisetlganktw
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cclK (K:)
    mealgadvtqglekgslitcadntgarelkvisvhgysgtknrhpkaglgdkitvsvtkg
    tpemrrqvleavvvrqrkpirrpdgtrvkfednaavivdenedprgtelkgpiarevaqr
    fgsvasaatmiv
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >3cclL (L:)
    mtskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqe
    eaatidvreidenvtllaaddvaevedggfrvdvrdvveeaddadyvkvlgagqvrhelt
    liaddfsegarekvegaggsveltdlgeerqaeaeetedadadee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclL (L:)
    tskkkrqrgsrthgggshknrrgaghrggrgdagrdkhefhnheplgksgfkrpqkvqee
    aatidvreidenvtllaaddvaefrvdvrdvveeaddadyvkvlgagqvrheltliaddf
    segarekvegaggsveltdlgeerq
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >3cclN (N:)
    matgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtla
    sahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiq
    egaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretl
    ldgdiel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclN (N:)
    atgprykvpmrrrreartdyhqrlrllksgkprlvarksnkhvraqlvtlgpngddtlas
    ahssdlaeygweaptgnmpsayltgllaglraqeagveeavldiglnsptpgskvfaiqe
    gaidagldiphnddvladwqrtrgahiaeydeqleeplysgdfdaadlpehfdelretll
    dgdiel
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >3cclO (O:)
    msktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvv
    vpgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclO (O:)
    sktnprlssliadlksaarssggavwgdvaerlekprrthaevnlgrieryaqedetvvv
    pgkvlgsgvlqkdvtvaavdfsgtaetkidqvgeavsleqaiennpegshvrvir
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >3cclP (P:)
    mtdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsr
    grarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqy
    rdlydkagggefdsvadleryidanhgda
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclP (P:)
    tdlsaqkrlaadvldvgknrvwfnperqgdiadaitredvrelvdegaiqakdkkgnsrg
    rarerqkkrayghqkgagsrkgkagarqnskedwesriraqrtklrelrdegtlsssqyr
    dlydkagggefdsvadleryida
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >3cclQ (Q:)
    mpssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgq
    tgtvegkqgdaykvdivdggkektiivtaahlrrqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclQ (Q:)
    pssngplegtrgklknkprdrgtsppqraveefddgekvhlkidpsvpngrfhprfdgqt
    gtvegkqgdaykvdivdggkektiivtaahlrrqe
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >3cclR (R:)
    mgisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpf
    kqhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkv
    geqqgrkpramgrasawnspqvdvelileepeved
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclR (R:)
    gisysveadpdttakamlrerqmsfkhskaiareikgktageavdyleaviegdqpvpfk
    qhnsgvghkskvdgwdagrypekaskafldllenavgnadhqgfdgeamtikhvaahkvg
    eqqgrkpramgrasawnspqvdvelileep
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >3cclS (S:)
    mswdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmd
    gekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclS (S:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasri
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >3cclT (T:)
    mskqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfagee
    gevinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclT (T:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >3cclU (U:)
    mprtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargea
    geaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclU (U:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtar
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >3cclV (V:)
    mtvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiarikti
    qgeegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclV (V:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegd
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cclW (W:)
    mhalvqlrgevnmhtdiqdtlemlnihhvnhctlvpetdayrgmvakvndfvafgepsqe
    tletvlatraeplegdadvddewvaehtdyddisglafallseettlreqglsptlrlhp
    prgghdgvkhpvkeggqlgkhdtegiddlleamr
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3cclX (X:)
    msasdfeervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaaw
    argrantpskirvraarfeeegeaiveaetae
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclX (X:)
    ervvtiplrdaraepnhkradkamilirehlakhfsvdedavrldpsineaawargrant
    pskirvraarfeeegeaiveae
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3cclY (Y:)
    madneedveaeeeyteltdisgvgpskaeslreagfesvedvrgadqsaladvsgignal
    aarikadvggleveseteaeveeeggeeapdedvetelqargltektpdlsdedarlltq
    rhrvgkpqfnrqdhhkkkrvstswrkprgqlskqrrgikgkgdtveagfrsptavrgkhp
    sgfeevrvhnvddlegvdgdteavriaskvgarkrerieeeaedagirvlnptyvevevs
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclY (Y:)
    telqargltektpdlsdedarlltqrhrvgkpqfnrqdhhkkkrvstswrkprgqlskqr
    rgikgkgdtveagfrsptavrgkhpsgfeevrvhnvddlegvdgdteavriaskvgarkr
    erieeeaedagirvlnptyvev
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3cclZ (Z:)
    msprarrepnleglmwplggqqttmasksgktgssgrfgarygrvsrrrvaeiesemned
    hacpncgedrvdrqgtgiwqcsycdykftggsykpetpggktvrrsiraalsedee
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cclZ (Z:)
    ssgrfgarygrvsrrrvaeiesemnedhacpncgedrvdrqgtgiwqcsycdykftggsy
    kpetpggktvrrs