PDB entry 3cch

View 3cch on RCSB PDB site
Description: H-2Db complex with murine gp100
Class: immune system
Keywords: murine MHC, Glycoprotein, Immune response, Membrane, MHC I, Transmembrane, Disease mutation, Melanin biosynthesis, IMMUNE SYSTEM
Deposited on 2008-02-25, released 2009-03-10
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.243
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cchb_
  • Chain 'C':
    Compound: nonameric peptide murine gp100
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CCH (0-8)
  • Chain 'D':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cche_
  • Chain 'F':
    Compound: nonameric peptide murine gp100
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CCH (0-8)
  • Chain 'G':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cchh_
  • Chain 'I':
    Compound: nonameric peptide murine gp100
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CCH (0-8)
  • Chain 'J':
    Compound: H-2 class I histocompatibility antigen, D-B alpha chain
    Species: Mus musculus [TaxId:10090]
    Gene: H2-D1
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Beta-2-microglobulin
    Species: Mus musculus [TaxId:10090]
    Gene: B2M
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d3cchk_
  • Chain 'L':
    Compound: nonameric peptide murine gp100
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3CCH (0-8)
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cchB (B:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cchE (E:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cchH (H:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3cchK (K:)
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

  • Chain 'L':
    No sequence available.