PDB entry 3cc6

View 3cc6 on RCSB PDB site
Description: Crystal structure of kinase domain of protein tyrosine kinase 2 beta (PTK2B)
Class: transferase
Keywords: FOCAL ADHESION KINASE, Structural Genomics, Structural Genomics Consortium, SGC, ATP-binding, Membrane, Nucleotide-binding, Phosphoprotein, Transferase, Tyrosine-protein kinase
Deposited on 2008-02-25, released 2008-03-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.187
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein tyrosine kinase 2 beta
    Species: Homo sapiens [TaxId:9606]
    Gene: PTK2B, FAK2, PYK2, RAFTK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3cc6a_
  • Heterogens: MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cc6A (A:)
    smggpqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekf
    mseavimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlysl
    qickamaylesincvhrdiavrnilvaspecvklgdfglsryiededyykasvtrlpikw
    mspesinfrrfttasdvwmfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcp
    pvlytlmtrcwdydpsdrprftelvcslsdvyqmekdiame
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cc6A (A:)
    gpqygiaredvvlnrilgegffgevyegvytnhkgekinvavktckkdctldnkekfmse
    avimknldhphivkligiieeeptwiimelypygelghylernknslkvltlvlyslqic
    kamaylesincvhrdiavrnilvaspecvklgdfglsryivtrlpikwmspesinfrrft
    tasdvwmfavcmweilsfgkqpffwlenkdvigvlekgdrlpkpdlcppvlytlmtrcwd
    ydpsdrprftelvcslsdvyqmekdiame