PDB entry 3cbs

View 3cbs on RCSB PDB site
Description: cellular retinoic acid binding protein II in complex with a synthetic retinoic acid (ro-12 7310)
Class: transport protein
Keywords: retinoic-acid transport, transport protein
Deposited on 1999-02-22, released 1999-12-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-11-02, with a file datestamp of 2011-10-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.2
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (crabp-II)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P29373 (0-136)
  Domains in SCOPe 2.06: d3cbsa_
• Heterogens: R12, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3cbsA (A:)
  pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
  teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtreltndgeli
  ltmtaddvvctrvyvre