PDB entry 3cbr

View 3cbr on RCSB PDB site
Description: Crystal structure of human Transthyretin (TTR) at pH3.5
Class: thyroxine binding protein
Keywords: TTR, AMYLOID, TRANSTHYRETIN, acidic pH, Disease mutation, Glycoprotein, Hormone, Polymorphism, Polyneuropathy, Retinol-binding, Secreted, Thyroid hormone, Vitamin A, TRANSPORT PROTEIN, THYROXINE BINDING PROTEIN
Deposited on 2008-02-22, released 2008-08-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.225
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: HOMO SAPIENS
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cbra_
  • Chain 'B':
    Compound: Transthyretin
    Species: HOMO SAPIENS
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cbrb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cbrA (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cbrA (A:)
    plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
    veidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cbrB (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cbrB (B:)
    plmvkvldavrgspainvavhvfrkadtwepfasgktsesgelhgltteeefvegiykve
    idtpfhehaevvftanrrytiaallspysysttavvt