PDB entry 3cbp

View 3cbp on RCSB PDB site
Description: Set7/9-ER-Sinefungin complex
Class: transferase/transferase receptor
Keywords: Estrogen Receptor, protein lysine methylation, Activator, Chromatin regulator, Chromosomal protein, Methyltransferase, Nucleus, S-adenosyl-L-methionine, Transcription, Transcription regulation, Transferase, DNA-binding, Lipid-binding, Metal-binding, Phosphoprotein, Steroid-binding, Zinc-finger, TRANSFERASE-TRANSFERASE RECEPTOR COMPLEX
Deposited on 2008-02-22, released 2008-05-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: 0.239
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone-lysine N-methyltransferase SETD7
    Species: Homo sapiens [TaxId:9606]
    Gene: SETD7, KIAA1717, KMT7, SET7, SET9
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3cbpa1, d3cbpa2
  • Chain 'B':
    Compound: Estrogen receptor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SFG, BME, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cbpA (A:)
    kdnirhgvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegkla
    tlmsteegrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissagegl
    fskvavgpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycas
    lghkanhsftpnciydmfvhprfgpikcirtlraveadeeltvaygydhsppgksgpeap
    ewyqvelkafqatqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cbpA (A:)
    gvcwiyypdggslvgevnedgemtgekiayvypdertalygkfidgemiegklatlmste
    egrphfelmpgnsvyhfdkstsscistnallpdpyeservyvaeslissageglfskvav
    gpntvmsfyngvrithqevdsrdwalngntlsldeetvidvpepynhvskycaslghkan
    hsftpnciydmfvhprfgpikcirtlraveadeeltvaygydheapewyqvelkafqat
    

  • Chain 'B':
    No sequence available.