PDB entry 3cbj

View 3cbj on RCSB PDB site
Description: Chagasin-Cathepsin B complex
Class: hydrolase/hydrolase inhibitor
Keywords: chagasin, cathepsin B, occluding loop, Chagas disease, Glycoprotein, Hydrolase, Lysosome, Polymorphism, Protease, Thiol protease, Zymogen, Cytoplasmic vesicle, Protease inhibitor, Thiol protease inhibitor, HYDROLASE/HYDROLASE INHIBITOR COMPLEX
Deposited on 2008-02-22, released 2008-05-27
The last revision prior to the SCOP 1.75 freeze date was dated 2008-06-10, with a file datestamp of 2008-06-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.165
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin b
    Species: HOMO SAPIENS
    Gene: CTSB, CPSB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07858 (62-End)
      • engineered (34)
      • engineered (115)
      • engineered (120)
  • Chain 'B':
    Compound: Chagasin
    Species: TRYPANOSOMA CRUZI
    Gene: cha
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d3cbjb1
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cbjB (B:)
    mshkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfpp
    dskllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cbjB (B:)
    shkvtkahngatltvavgelveiqlpsnpttgfawyfeggtkespnesmftvenkyfppd
    skllgaggtehfhvtvkaagthavnltymrpwtgpshdserftvylkan