PDB entry 3cbh

View 3cbh on RCSB PDB site
Description: three-dimensional structure of cellobiohydrolase from trichoderma reesei
Deposited on 1990-08-06, released 1991-01-15
The last revision prior to the SCOP 1.55 freeze date was dated 1991-01-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.155
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d3cbh__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cbh_ (-)
    sgtatysgnpfvgvtpwanayyasevsslaipsltgamataaaavakvpsfmwldtldkt
    plmeqtladirtanknggnyagqfvvydlpdrdcaalasngeysiadggvakyknyidti
    rqivveysdirtllviepdslanlvtnlgtpkcanaqsaylecinyavtqlnlpnvamyl
    daghagwlgwpanqdpaaqlfanvyknasspralrglatnvanyngwnitsppsytqgna
    vyneklyihaigpllanhgwsnaffitdqgrsgkqptgqqqwgdwcnvigtgfgirpsan
    tgdslldsfvwvkpggecdgtsdssaprfdshcalpdalqpapqagawfqayfvqlltna
    npsfl