SCOP: Structural Classification of Proteins and ASTRAL

Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)

PDB entry 3car

View 3car on RCSB PDB site
Description: reduced structure of the acidic cytochrome c3 from desulfovibrio africanus
Class: electron transport
Keywords: cytochrome c3, tetraheme, reduced form, electron transport, desulfovibrio africanus
Deposited on 1998-11-17, released 2000-07-23
The last revision prior to the SCOP 1.75B freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.198
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: cytochrome c3
Species: Desulfovibrio africanus [TaxId:873]
Domains in SCOP 1.75B: d3cara_
Heterogens: ZN, HEM, ARS, HOH

PDB Chain Sequences:

Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)

>3carA (A:)
xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn