PDB entry 3cao

View 3cao on RCSB PDB site
Description: oxidised structure of the acidic cytochrome c3 from desulfovibrio africanus
Class: electron transport
Keywords: cytochrome c3, tetraheme, oxidised form, electron transport, desulfovibrio africanus
Deposited on 1998-11-17, released 2000-07-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c3
    Species: Desulfovibrio africanus [TaxId:873]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3caoa_
  • Heterogens: ZN, HEM, ARS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3caoA (A:)
    xedmthvptdafgklerpaavfnhdehnekagiescnachhvwvngvlaededsvgtpcs
    dchaleqdgdtpglqdayhqqcwgchekqakgpvmcgechvkn