PDB entry 3cam

View 3cam on RCSB PDB site
Description: Crystal structure of the cold shock domain protein from Neisseria meningitidis
Class: gene regulation
Keywords: Neisseria meningitidis, cold shock protein, chain swap, Structural Genomics, Oxford Protein Production Facility, OPPF, GENE REGULATION
Deposited on 2008-02-20, released 2008-03-25
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.236
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Cold-shock domain family protein
  Species: Neisseria meningitidis MC58 [TaxId:122586]
  Gene: NMB0838
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZZ4 (0-66)
  Domains in SCOPe 2.03: d3cama_
• Chain 'B':
  Compound: Cold-shock domain family protein
  Species: Neisseria meningitidis MC58 [TaxId:122586]
  Gene: NMB0838
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9JZZ4 (0-66)
  Domains in SCOPe 2.03: d3camb_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3camA (A:)
  matgivkwfndakgfgfitpdeggedlfahfsainmegfktlkegqrvsfdvttgpkgkq
  aaniqaa
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3camB (B:)
  matgivkwfndakgfgfitpdeggedlfahfsainmegfktlkegqrvsfdvttgpkgkq
  aaniqaa