PDB entry 3caf

View 3caf on RCSB PDB site
Description: Crystal Structure of hFGFR2 D2 Domain
Class: transferase
Keywords: FGFR2, D2, Fibroblast Growth Factor, ATP-binding, Disease mutation, Ectodermal dysplasia, Glycoprotein, Heparin-binding, Immunoglobulin domain, Kinase, Lacrimo-auriculo-dento-digital syndrome, Membrane, Nucleotide-binding, Phosphoprotein, Receptor, Secreted, Transferase, Transmembrane, Tyrosine-protein kinase
Deposited on 2008-02-19, released 2009-01-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.191
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: FGFR2, BEK, KGFR, KSAM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3cafa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3cafA (A:)
    nkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggykv
    rnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv