PDB entry 3caa

View 3caa on RCSB PDB site
Description: cleaved antichymotrypsin a347r
Class: serpin
Keywords: serpin, serine protease inhibitor, antichymotrypsin
Deposited on 1997-08-18, released 1998-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.19
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: ACT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01011 (Start-340)
      • engineered (329)
    Domains in SCOPe 2.06: d3caa.1
  • Chain 'B':
    Compound: antichymotrypsin
    Species: Homo sapiens [TaxId:9606]
    Gene: ACT
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3caa.1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3caaA (A:)
    thvdlglasanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkg
    lkfnltetseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlyg
    seafatdfqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfd
    pqdthqsrfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqd
    kmeeveamllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskad
    lsgitgarnlavsqvvhkavldvfeegtersaatavkitll
    

    Sequence, based on observed residues (ATOM records): (download)
    >3caaA (A:)
    asanvdfafslykqlvlkapdknvifsplsistalaflslgahnttlteilkglkfnlte
    tseaeihqsfqhllrtlnqssdelqlsmgnamfvkeqlslldrftedakrlygseafatd
    fqdsaaakklindyvkngtrgkitdlikdldsqtmmvlvnyiffkakwempfdpqdthqs
    rfylskkkwvmvpmmslhhltipyfrdeelsctvvelkytgnasalfilpdqdkmeevea
    mllpetlkrwrdslefreigelylpkfsisrdynlndillqlgieeaftskadlsgitga
    rnlavsqvvhkavldvfeegtersaatavkitll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3caaB (B:)
    vetrtivrfnrpflmiivptdtqniffmskvtnpkqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >3caaB (B:)
    rtivrfnrpflmiivptdtqniffmskvtnpk