PDB entry 3ca7

View 3ca7 on RCSB PDB site
Description: High Resolution Crystal Structure of the EGF domain of Spitz
Deposited on 2008-02-19, released 2008-05-20
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.201
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein spitz
    Species: Drosophila melanogaster
    Gene: spi
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3ca7A (A:)
tfptykcpetfdawyclndahcfavkiadlpvyscecaigfmgqrceykeid

    Sequence, based on observed residues (ATOM records):
    >3ca7A (A:)
tfptykcpetfdawyclndahcfavkiadlpvyscecaigfmgqrceyke