PDB entry 3c9y

View 3c9y on RCSB PDB site
Description: Crystal structure of Trichoderma reesei aspartic proteinase complexed with pepstatin A
Deposited on 2008-02-19, released 2008-08-19
The last revision was dated 2008-10-07, with a file datestamp of 2008-10-03.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.161
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trichoderma reesei Aspartic protease
    Species: Trichoderma reesei
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2WBH2 (0-328)
      • modified residue (0)
  • Chain 'B':
    Compound: pepstatin A
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 3C9Y (0-2)
  • Heterogens: STA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3c9yA (A:)
etgsapnhpsdsadseyitsvsigtpaqvlpldfdtgssdlwvfssetpkssatghaiyt
psksstskkvsgaswsisygdgssssgdvytdkvtiggfsvntqgvesatrvstefvqdt
visglvglafdsgnqvrphpqktwfsnaasslaeplftadlrhgqngsynfgyidtsvak
gpvaytpvdnsqgfweftasgysvgggklnrnsidgiadtgttllllddnvvdayyanvq
saqydnqqegvvfdcdedlpsfsfgvgsstitipgdllnltpleegsstcfgglqsssgi
ginifgdvalkaalvvfdlgnerlgwaqk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >3c9yB (B:)
xvv