PDB entry 3c9f

View 3c9f on RCSB PDB site
Description: Crystal structure of 5'-nucleotidase from Candida albicans SC5314
Class: hydrolase
Keywords: 5'-NUCLEOTIDASE, 2',3'-cyclic phosphodiesterase, PROTEIN STRUCTURE INITIATIVE, PSI-2, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, STRUCTURAL GENOMICS, HYDROLASE
Deposited on 2008-02-15, released 2008-02-26
The last revision prior to the SCOP 1.75 freeze date was dated 2008-02-26, with a file datestamp of 2008-02-22.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.188
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-nucleotidase
    Species: Candida albicans SC5314
    Gene: USHA, CaO19.12802, CaO19.5342
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5A5Q7 (Start-548)
      • engineered (50)
      • engineered (139)
      • engineered (145)
      • engineered (160)
      • engineered (311)
      • engineered (355)
      • expression tag (549)
    Domains in SCOP 1.75: d3c9fa1, d3c9fa2
  • Chain 'B':
    Compound: 5'-nucleotidase
    Species: Candida albicans SC5314
    Gene: USHA, CaO19.12802, CaO19.5342
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5A5Q7
      • engineered (50)
      • engineered (139)
      • engineered (145)
      • engineered (160)
      • engineered (311)
      • engineered (355)
    Domains in SCOP 1.75: d3c9fb1, d3c9fb2
  • Heterogens: ZN, NA, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c9fA (A:)
    mslasfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnq
    dlllidsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvv
    nhfqdkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtp
    maetihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghsh
    irdftvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtn
    ldkefdtakgklvskliretrkelkldtligyvktnyyvdyvpidhpksifnllalkilk
    tlpkskheeritiintgsirydlykgpytidskfivspfeniwvnitvpksvatkvaakl
    ndadyisasrlkpphqydlqvqdlstsphqahfemqeklpkgyvthddfgadgddtlhra
    vvnfpvpnviqsveindevdspvnlvfysfitpniiwalkelnfsteqvptpysdiylgt
    llnefvanneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c9fA (A:)
    sfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnqdlll
    idsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfq
    dkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtpmaet
    ihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdf
    tvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldke
    fdtakgklvskliretrkelkldtligyvktnyyvdyvpidhpksifnllalkilktlpk
    skheeritiintgsirydlykgpytidskfivspfeniwvnitvpksvatkvaaklndyi
    sasrlkpphqydlqvqqeklpkgyvthddfgadgddtlhravvnfpvpnviqsveindev
    dspvnlvfysfitpniiwalkelnfsteqvptpysdiylgtllnefvanne
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c9fB (B:)
    mslasfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnq
    dlllidsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvv
    nhfqdkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtp
    maetihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghsh
    irdftvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtn
    ldkefdtakgklvskliretrkelkldtligyvktnyyvdyvpidhpksifnllalkilk
    tlpkskheeritiintgsirydlykgpytidskfivspfeniwvnitvpksvatkvaakl
    ndadyisasrlkpphqydlqvqdlstsphqahfemqeklpkgyvthddfgadgddtlhra
    vvnfpvpnviqsveindevdspvnlvfysfitpniiwalkelnfsteqvptpysdiylgt
    llnefvanneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c9fB (B:)
    sfphrnltwndinfvhttdthgwysghinqplyhanwgdfisftthmrriahsrnqdlll
    idsgdrhdgnglsditspnglkstpifikqdydlltignhelylwenskqeyetvvnhfq
    dkyvcsnvdirldnglfvplglkykyfttpirgirvmafgflfdfkrfnsgtrvtpmaet
    ihepwfqealkhevdliiivghtpishnwgefyqvhqylrqffpdtiiqyfgghshirdf
    tvfdslstglqsgrycetvgwtsvnldkadlnlpvrqrfsrsyidfntdsfkyhtnldke
    fdtakgklvskliretrkelkldtligyvktnyyvdyvpidhpksifnllalkilktlpk
    skheeritiintgsirydlykgpytidskfivspfeniwvnitvpksvatkvaaklndis
    asrlkpphqydlqvqlstsphqahfemqeklpkgyvthddfgadgddtlhravvnfpvpn
    viqsveindevdspvnlvfysfitpniiwalkelnfsteqvptpysdiylgtllnefvan