PDB entry 3c9e

View 3c9e on RCSB PDB site
Description: Crystal structure of the cathepsin K : chondroitin sulfate complex.
Class: hydrolase
Keywords: n:1 cathepsin K : chondroitin sulfate complex, "beads-on-a-string" organization, Hydrolase, Lysosome, Protease, Thiol protease
Deposited on 2008-02-15, released 2008-08-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-02-17, with a file datestamp of 2016-02-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cathepsin k
    Species: Homo sapiens [TaxId:9606]
    Gene: CTSK, CTSO, CTSO2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c9ea_
  • Heterogens: CA, E64, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c9eA (A:)
    apdsvdyrkkgyvtpvknqgqcgscwafssvgalegqlkkktgkllnlspqnlvdcvsen
    dgcgggymtnafqyvqknrgidsedaypyvgqeescmynptgkaakcrgyreipegneka
    lkravarvgpvsvaidasltsfqfyskgvyydescnsdnlnhavlavgygiqkgnkhwii
    knswgenwgnkgyilmarnknnacgianlasfpkm