PDB entry 3c99

View 3c99 on RCSB PDB site
Description: Structural Basis of Histone H4 Recognition by p55
Class: transcription repressor
Keywords: WD40, histone binding, chromatin, epigenetics, Chromatin regulator, Nucleus, Phosphoprotein, Repressor, Transcription, Transcription regulation, WD repeat, NUCLEAR PROTEIN, TRANSCRIPTION REPRESSOR
Deposited on 2008-02-15, released 2008-05-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.219
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chromatin assembly factor 1 p55 subunit
    Species: Drosophila melanogaster [TaxId:7227]
    Gene: CAF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c99a_
  • Heterogens: CD

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c99A (A:)
    gamvdrsdnaaesfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvt
    kqdgkdysvhrlilgthtsdeqnhlliasvqlpsedaqfdgshydnekgefggfgsvcgk
    ieieikinhegevnrarympqnacviatktpssdvlvfdytkhpskpepsgecqpdlrlr
    ghqkegyglswnpnlngyllsasddhticlwdinatpkehrvidakniftghtavvedva
    whllheslfgsvaddqklmiwdtrnnntskpshtvdahtaevnclsfnpysefilatgsa
    dktvalwdlrnlklklhsfeshkdeifqvqwsphnetilassgtdrrlhvwdlskigeeq
    stedaedgppellfihgghtakisdfswnpnepwiicsvsednimqvwqmaenvyndeep
    eipaseletnta
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c99A (A:)
    sfddaveervineeykiwkkntpflydlvmthalewpsltaqwlpdvtkqdgkdysvhrl
    ilgthtsdeqnhlliasvqlpsedfgsvcgkieieikinhegevnrarympqnacviatk
    tpssdvlvfdytkhpcqpdlrlrghqkegyglswnpnlngyllsasddhticlwdinatp
    kehrvidakniftghtavvedvawhllheslfgsvaddqklmiwdtrnnntskpshtvda
    htaevnclsfnpysefilatgsadktvalwdlrnlklklhsfeshkdeifqvqwsphnet
    ilassgtdrrlhvwdlskigeeqstedaedgppellfihgghtakisdfswnpnepwiic
    svsednimqvwqmaenvynd