PDB entry 3c97

View 3c97 on RCSB PDB site
Description: Crystal structure of the response regulator receiver domain of a signal transduction histidine kinase from Aspergillus oryzae
Class: signaling protein, transferase
Keywords: STRUCTURAL GENOMICS, SIGNALING, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, Kinase, SIGNALING PROTEIN, TRANSFERASE
Deposited on 2008-02-15, released 2008-03-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2021-02-03, with a file datestamp of 2021-01-29.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal transduction histidine kinase
    Species: Aspergillus oryzae [TaxId:510516]
    Gene: AO090701000184
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3c97a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c97A (A:)
    mslepsqimplsvliaedndicrlvaakalekctnditvvtnglqalqayqnrqfdviim
    diqmpvmdgleavseirnyerthntkrasiiaitadtidddrpgaeldeyvskplnpnql
    rdvvltchsegaeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c97A (A:)
    plsvliaedndicrlvaakalekctnditvvtnglqalqayqnrqfdviimdiqmpvmdg
    leavseirnyerthntkrasiiaitadtidddrpgaeldeyvskplnpnqlrdvvltchs