PDB entry 3c96

View 3c96 on RCSB PDB site
Description: Crystal structure of the flavin-containing monooxygenase phzS from Pseudomonas aeruginosa. Northeast Structural Genomics Consortium target PaR240
Class: oxidoreductase
Keywords: FAD, MONOOXYGENASE, OXIDOREDUCTASE, PF01266, NESG, PaR240, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2008-02-15, released 2008-02-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.183
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Flavin-containing monooxygenase
    Species: Pseudomonas aeruginosa PAO1 [TaxId:208964]
    Gene: phzS, PA4217
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HWG9 (Start-401)
      • expression tag (402)
    Domains in SCOPe 2.06: d3c96a1, d3c96a2, d3c96a3
  • Heterogens: FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c96A (A:)
    msepidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealael
    glgpalaataipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrer
    lgqqavrtglgverieerdgrvligardghgkpqalgadvlvgadgihsavrahlhpdqr
    plshggitmwrgvtefdrfldgktmivandehwsrlvaypisarhaaegkslvnwvcmvp
    saavgqldneadwnrdgrledvlpffadwdlgwfdirdlltrnqlilqypmvdrdplphw
    grgritllgdaahlmypmgangasqaildgielaaalarnadvaaalreyeearrptank
    iilanrerekeewaaasrpkteksaaleaitgsyrnqverprlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c96A (A:)
    pidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealaelglg
    palaataipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrerlgq
    qavrtglgverieerdgrvligardghgkpqalgadvlvgadgihsavrahlhpdqrpls
    hggitmwrgvtefdrfldgktmivandehwsrlvaypisarhaaegkslvnwvcmvpsaa
    vgqldneadwnrdgrledvlpffadwdlgwfdirdlltrnqlilqypmvdrdplphwgrg
    ritllgdaahlmypmgangasqaildgielaaalarnadvaaalreyeearrptankiil
    anrerekeewaaasrperprl