PDB entry 3c8t

View 3c8t on RCSB PDB site
Description: Crystal structure of fumarate lyase from Mesorhizobium sp. BNC1
Class: lyase
Keywords: STRUCTURAL GENOMICS, LYASE, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC
Deposited on 2008-02-13, released 2008-03-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate lyase
    Species: Mesorhizobium sp. [TaxId:266779]
    Gene: Meso_3622
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3c8ta_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c8tA (A:)
    msldsplygrsfaddkmrelfsaqsfisrcvetevalaraqarlgiipedaaagitaaar
    tfapemerlrddteivgypilplveqlsahageagkylhwgattqdimdtatvlqirdgl
    alisrriesvrkalaalarnhrdtpmagrthlqhalpvtfgykaavwlsafdrhaarlee
    isprvlvvefsgasgtlaslgtrgldvqrelarelnlgvpsitwhsardavaetvqflal
    vsgslgklamdisimmttelgevaepfvrhrgasstmpqkqnpvscelilagarivrnha
    tsmldamihdferatgpwhlewsavpegfavasgilyqaefmlgglqvfpdrmrenldhs
    rglivaeavmmalaphtgrkeahdivylgcrravedktglfevlrtmpevakplgeealr
    dltdprnylgsagamvdnvlggreghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8tA (A:)
    plygrsfaddkmrelfsaqsfisrcvetevalaraqarlgiipedaaagitaaartfape
    merlrddteivgypilplveqlsahageagkylhwgattqdimdtatvlqirdglalisr
    riesvrkalaalarnhrdtpmagrthlqhalpvtfgykaavwlsafdrhaarleeisprv
    lvvefsgasgtlaslgtrgldvqrelarelnlgvpsitwhsardavaetvqflalvsgsl
    gklamdisimmttelgevaepnpvscelilagarivrnhatsmldamihdferatgpwhl
    ewsavpegfavasgilyqaefmlgglqvfpdrmrenldhsrglivaeavmmalaphtgrk
    eahdivylgcrravedktglfevlrtmpevakplgeealrdltdprnylgsagamvdnvl
    ggr