PDB entry 3c8n

View 3c8n on RCSB PDB site
Description: Crystal structure of apo-FGD1 from Mycobacterium tuberculosis
Class: oxidoreductase
Keywords: TIM barrel, non-prolyl cis-peptide, Oxidoreductase
Deposited on 2008-02-12, released 2008-04-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.214
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fgd1, fgd, MT0420, Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253 (20-End)
      • expression tag (7-17)
      • engineered (262)
    Domains in SCOPe 2.06: d3c8na1, d3c8na2
  • Chain 'B':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fgd1, fgd, MT0420, Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253 (20-End)
      • engineered (262)
    Domains in SCOPe 2.06: d3c8nb_
  • Chain 'C':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fgd1, fgd, MT0420, Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253
      • engineered (262)
    Domains in SCOPe 2.06: d3c8nc_
  • Chain 'D':
    Compound: probable f420-dependent glucose-6-phosphate dehydrogenase fgd1
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: fgd1, fgd, MT0420, Rv0407
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96253
      • engineered (262)
    Domains in SCOPe 2.06: d3c8nd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c8nA (A:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8nA (A:)
    hhhssglvprgmelklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqggh
    apfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgea
    lneiatgyegawpefkerfarlresvglmrqlwsdrvdfdgdyyrlkgasiydvpdggvp
    vyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmiei
    kisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpd
    eavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c8nB (B:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8nB (B:)
    maelklgykasaeqfaprelvelavaaeahgmdsatvsdhfqphqgghapfslswmtavg
    ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
    pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
    kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
    mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
    wglnhlvfhapghdqrrflelfqsdlaprlrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c8nC (C:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8nC (C:)
    elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
    ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgyegaw
    pefkerfarlresvglmrqlwsgdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpava
    kyagragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpela
    mnntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvt
    wglnhlvfhapghdqrrflelfqsdlaprlrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c8nD (D:)
    mgsshhhhhhssglvprgshmaelklgykasaeqfaprelvelavaaeahgmdsatvsdh
    fqpwrhqgghapfslswmtavgertnrlllgtsvltptfrynpaviaqafatmgclypnr
    vflgvgtgealneiatgyegawpefkerfarlresvglmrqlwsgdrvdfdgdyyrlkga
    siydvpdggvpvyiaaggpavakyagragdgfictsgkgeelyteklmpavregaaaadr
    svdgidkmieikisydpdpelamnntrfwaplsltaeqkhsiddpiemekaadalpieqi
    akrwivasdpdeavekvgqyvtwglnhlvfhapghdqrrflelfqsdlaprlrrlg
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8nD (D:)
    elklgykasaeqfaprelvelavaaeahgmdsatvsdhfqpwrhqgghapfslswmtavg
    ertnrlllgtsvltptfrynpaviaqafatmgclypnrvflgvgtgealneiatgygawp
    efkerfarlresvglmrqlwsdrvdfdgdyyrlkgasiydvpdggvpvyiaaggpavaky
    agragdgfictsgkgeelyteklmpavregaaaadrsvdgidkmieikisydpdpelamn
    ntrfwaplsltaeqkhsiddpiemekaadalpieqiakrwivasdpdeavekvgqyvtwg
    lnhlvfhapghdqrrflelfqsdlaprlrr