PDB entry 3c8j

View 3c8j on RCSB PDB site
Description: The crystal structure of natural killer cell receptor Ly49C
Class: immune system
Keywords: Natural killer cell receptor, MHC, Virus, Crystal structure, IMMUNE SYSTEM
Deposited on 2008-02-12, released 2008-04-15
The last revision prior to the SCOP 1.75 freeze date was dated 2008-04-15, with a file datestamp of 2008-04-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Natural killer cell receptor Ly49C
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61198 (Start-202)
      • engineered (111)
      • engineered (133)
      • engineered (163)
    Domains in SCOP 1.75: d3c8ja1
  • Chain 'B':
    Compound: Natural killer cell receptor Ly49C
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61198 (Start-202)
      • engineered (111)
      • engineered (133)
      • engineered (163)
    Domains in SCOP 1.75: d3c8jb1
  • Chain 'C':
    Compound: Natural killer cell receptor Ly49C
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61198 (Start-202)
      • engineered (111)
      • engineered (133)
      • engineered (163)
    Domains in SCOP 1.75: d3c8jc1
  • Chain 'D':
    Compound: Natural killer cell receptor Ly49C
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q61198 (Start-202)
      • engineered (111)
      • engineered (133)
      • engineered (163)
    Domains in SCOP 1.75: d3c8jd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c8jA (A:)
    maskifqynqhkqetnetlnhhncsnmqrafnlkeemltnksidcrpsnetleyikgeqh
    drwdsktktvldssrdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkied
    edelkflqrhvipgnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskar
    iedidcnipyycicgkkldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8jA (A:)
    tgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgny
    wiglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgk
    kldkfpd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c8jB (B:)
    maskifqynqhkqetnetlnhhncsnmqrafnlkeemltnksidcrpsnetleyikgeqh
    drwdsktktvldssrdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkied
    edelkflqrhvipgnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskar
    iedidcnipyycicgkkldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8jB (B:)
    grgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnyw
    iglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkk
    ldkfpd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3c8jC (C:)
    maskifqynqhkqetnetlnhhncsnmqrafnlkeemltnksidcrpsnetleyikgeqh
    drwdsktktvldssrdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkied
    edelkflqrhvipgnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskar
    iedidcnipyycicgkkldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8jC (C:)
    grgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvipgnyw
    iglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyycicgkk
    ldkfpd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3c8jD (D:)
    maskifqynqhkqetnetlnhhncsnmqrafnlkeemltnksidcrpsnetleyikgeqh
    drwdsktktvldssrdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkied
    edelkflqrhvipgnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskar
    iedidcnipyycicgkkldkfpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c8jD (D:)
    srdtgrgvkywfcystkcyyfimnkttwsgckancqhygvpilkiededelkflqrhvip
    gnywiglsydkkkkewawidngpskldmkikkmnfksrgcvflskariedidcnipyyci
    cgkkldkfpd