PDB entry 3c86

View 3c86 on RCSB PDB site
Description: OpdA from agrobacterium radiobacter with bound product diethyl thiophosphate from crystal soaking with tetraethyl dithiopyrophosphate- 1.8 A
Class: hydrolase
Keywords: phosphotriesterase, opdA, metalloenzyme, HYDROLASE
Deposited on 2008-02-10, released 2008-02-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-07-07, with a file datestamp of 2009-07-02.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.163
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Agrobacterium tumefaciens [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7 (0-327)
      • engineered (58)
    Domains in SCOPe 2.07: d3c86a_
  • Heterogens: FE2, CO, DPJ, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c86A (A:)
    gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalaekavrglrharaa
    gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltqfflre
    iqhgiedtgiragiikvattgkatpfqelvlkaaaraslatgvpvtthtsasqrdgeqqa
    aifeseglspsrvcighsddtddlsyltglaargylvgldrmpysaiglegnasalalfg
    trswqtrallikalidrgykdrilvshdwlfgfssyvtnimdvmdrinpdgmafvplrvi
    pflrekgvppetlagvtvanparflspt