PDB entry 3c7x

View 3c7x on RCSB PDB site
Description: Hemopexin-like domain of matrix metalloproteinase 14
Class: hydrolase
Keywords: membrane protein interaction, pro-MMP-2, TIMP-2, metastasis, Cleavage on pair of basic residues, Hydrolase, Metal-binding, Metalloprotease, Protease, Transmembrane, Zymogen
Deposited on 2008-02-08, released 2009-02-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2012-12-26, with a file datestamp of 2012-12-21.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.185
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Matrix metalloproteinase-14
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3c7xa_
  • Heterogens: NA, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3c7xA (A:)
    pnicdgnfdtvamlrgemfvfkerwfwrvrnnqvmdgypmpigqfwrglpasintayerk
    dgkfvffkgdkhwvfdeaslepgypkhikelgrglptdkidaalfwmpngktyffrgnky
    yrfneelravdseypknikvwegipesprgsfmgsdevftyfykgnkywkfnnqklkvep
    gypksalrdwmgcpsg