PDB entry 3c7n

View 3c7n on RCSB PDB site
Description: Structure of the Hsp110:Hsc70 Nucleotide Exchange Complex
Class: chaperone/chaperone
Keywords: chaperone, HSP110, HSP70, HSC70, molecular chaperone, ATP state, acetylation, ATP-binding, ADP, calmodulin binding, cytoplasm, mucleotide binding, phosphorylation, stress response, Calmodulin-binding, Nucleotide-binding, Phosphoprotein, Nucleus, TRANSCRIPTION, CHAPERONE/CHAPERONE COMPLEX
Deposited on 2008-02-07, released 2008-05-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.12 Å
R-factor: 0.227
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein homolog SSE1
    Species: SACCHAROMYCES CEREVISIAE
    Gene: SSE1, MSI3
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Heat shock cognate
    Species: BOS TAURUS
    Gene: HSPA8, HSC70
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c7nb1, d3c7nb2, d3c7nb3
  • Heterogens: MG, CL, SO4, BEF, ADP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3c7nB (B:)
    mskgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqva
    mnptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevs
    smvltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaa
    iaygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnh
    fiaefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitra
    rfeelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkeln
    ksinpdeavaygaavqaailsgdksenvqdlllldvtplslgietaggvmtvlikrntti
    ptkqtqtfttysdnqpgvliqvyegeramtkdnnllgkfeltgippaprgvpqievtfdi
    dangilnvsavdkstgkenkititndkgrlskediermvqeaekykaedekqrdkvsskn
    slesyafnmkatve
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c7nB (B:)
    kgpavgidlgttyscvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamn
    ptntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssm
    vltkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaia
    ygldkkvgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfi
    aefkrkhkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarf
    eelnadlfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnks
    inpdeavaygaavqaailsgdkdlllldvtplslgietaggvmtvlikrnttiptkqtqt
    fttysdnqpgvliqvyegeramtkdnnllgkfeltgippaprgvpqievtfdidangiln
    vsavdkstgkenkititndkgrlskediermvqeaekykaedekqrdkvssknslesyaf