PDB entry 3c7i

View 3c7i on RCSB PDB site
Description: X-RAY crystal structure of the complex between the grb2-sh2 domain and a flexible ligand, FPTVN.
Class: splicing
Keywords: FLEXIBLE, CONSTRAINED, ENTROPY, GRB2-SH2, LIGAND PREORGANIZATION, Alternative splicing, Host-virus interaction, Phosphoprotein, SH2 domain, SH3 domain
Deposited on 2008-02-07, released 2008-08-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3c7ia_
  • Heterogens: TVN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3c7iA (A:)
    iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
    dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3c7iA (A:)
    mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
    agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp